Brp16 Antibody
| Name | Brp16 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-54697 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a Recombinant Protein corresponding to amino acids:LVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENLLEVQVPEDVEQQLQQLDCREQEQLEREL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Brp16 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HGH1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Brp16 Antibody [NBP2-54697] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26306_Brp16-Antibody-Western-Blot-NBP2-54697-img0002.jpg)
Western Blot: Brp16 Antibody [NBP2-54697] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue
![Immunohistochemistry-Paraffin: Brp16 Antibody [NBP2-54697] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26307_Brp16-Antibody-Immunohistochemistry-Paraffin-NBP2-54697-img0004.jpg)
Immunohistochemistry-Paraffin: Brp16 Antibody [NBP2-54697] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
![Immunohistochemistry-Paraffin: Brp16 Antibody [NBP2-54697] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26308_Brp16-Antibody-Immunohistochemistry-Paraffin-NBP2-54697-img0003.jpg)
Immunohistochemistry-Paraffin: Brp16 Antibody [NBP2-54697] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.