YIPF3 Antibody
| Name | YIPF3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56181 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREEEVDADAADAAAAEEEDGEFLGM |
| Purity/Format | Affinity purified |
| Blocking Peptide | YIPF3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | YIPF3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: YIPF3 Antibody [NBP2-56181] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26312_YIPF3%2520Antibody-Western%2520Blot-NBP2-56181-img0003.jpg)
Western Blot: YIPF3 Antibody [NBP2-56181] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
![Immunocytochemistry/Immunofluorescence: YIPF3 Antibody [NBP2-56181] - Immunohistochemical staining of human epididymis shows cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26313_YIPF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56181-img0002.jpg)
Immunocytochemistry/Immunofluorescence: YIPF3 Antibody [NBP2-56181] - Immunohistochemical staining of human epididymis shows cytoplasmic positivity in glandular cells.
![Immunocytochemistry/Immunofluorescence: YIPF3 Antibody [NBP2-56181] - Staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26314_YIPF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56181-img0001.jpg)
Immunocytochemistry/Immunofluorescence: YIPF3 Antibody [NBP2-56181] - Staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus.