LSM14B Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-56828
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAK
• Purity/Format: Affinity purified
• Blocking Peptide: LSM14B Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: LSM14B
• Conjugate: Unconjugated

Product images

Western Blot: LSM14B Antibody [NBP2-56828] - Western blot analysis in control (vector only transfected HEK293T lysate) and LSM14B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: LSM14B Antibody [NBP2-56828] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts.

Immunocytochemistry/Immunofluorescence: LSM14B Antibody [NBP2-56828] - Staining of human cell line SiHa shows localization to vesicles.