YIPF5 Antibody
| Name | YIPF5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-57970 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPD |
| Purity/Format | Affinity purified |
| Blocking Peptide | YIPF5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | YIPF5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: YIPF5 Antibody [NBP2-57970] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26557_YIPF5%2520Antibody-Western%2520Blot-NBP2-57970-img0003.jpg)
Western Blot: YIPF5 Antibody [NBP2-57970] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
![Immunocytochemistry/Immunofluorescence: YIPF5 Antibody [NBP2-57970] - Staining of human cell line BJ shows localization to endoplasmic reticulum & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26558_YIPF5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57970-img0001.jpg)
Immunocytochemistry/Immunofluorescence: YIPF5 Antibody [NBP2-57970] - Staining of human cell line BJ shows localization to endoplasmic reticulum & vesicles.
![Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells and islets of Langerhans.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26559_YIPF5-Antibody-Immunohistochemistry-Paraffin-NBP2-57970-img0002.jpg)
Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells and islets of Langerhans.