CXorf61 Antibody
| Name | CXorf61 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-59062 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 |
| Applications | WB IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
| Purity/Format | Protein A purified |
| Description | Mouse Monoclonal |
| Gene | CT83 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CXorf61 Antibody [NBP2-59062] - Analysis in human cell line HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26950_CXorf61%2520Antibody-Western%2520Blot-NBP2-59062-img0003.jpg)
Western Blot: CXorf61 Antibody [NBP2-59062] - Analysis in human cell line HeLa.
![Immunohistochemistry-Paraffin: CXorf61 Antibody [NBP2-59062] - Staining of human cervix shows no positivity as expected (negative control).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26951_CXorf61-Antibody-Immunohistochemistry-Paraffin-NBP2-59062-img0002.jpg)
Immunohistochemistry-Paraffin: CXorf61 Antibody [NBP2-59062] - Staining of human cervix shows no positivity as expected (negative control).
![Immunohistochemistry-Paraffin: CXorf61 Antibody [NBP2-59062] - Staining of human testis shows strong positivity in a subset of cells in seminiferous tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26952_CXorf61-Antibody-Immunohistochemistry-Paraffin-NBP2-59062-img0001.jpg)
Immunohistochemistry-Paraffin: CXorf61 Antibody [NBP2-59062] - Staining of human testis shows strong positivity in a subset of cells in seminiferous tubules.