GNL1 Antibody

Name GNL1 Antibody
Supplier Novus Biologicals
Catalog NBP2-54938
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VAWKHYFHQHYPQLHVVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLRACEAITVGKVDLSSWREKIARDVAGATWGNGSGE
Purity/Format Affinity purified
Blocking Peptide GNL1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene GNL1
Conjugate Unconjugated
Supplier Page Shop

Product images