CTP synthase Antibody
| Name | CTP synthase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-57099 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD |
| Purity/Format | Affinity purified |
| Blocking Peptide | CTP synthase Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CTPS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CTP synthase Antibody [NBP2-57099] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5397_CTP%2520synthase%2520Antibody-Western%2520Blot-NBP2-57099-img0002.jpg)
Western Blot: CTP synthase Antibody [NBP2-57099] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
![Immunocytochemistry/Immunofluorescence: CTP synthase Antibody [NBP2-57099] - Staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & actin filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5398_CTP-synthase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57099-img0001.jpg)
Immunocytochemistry/Immunofluorescence: CTP synthase Antibody [NBP2-57099] - Staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & actin filaments.