MED10 Antibody
| Name | MED10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-58707 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVP |
| Purity/Format | Affinity purified |
| Blocking Peptide | MED10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MED10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MED10 Antibody [NBP2-58707] - Western blot analysis in control (vector only transfected HEK293T lysate) and MED10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7262_MED10%2520Antibody-Western%2520Blot-NBP2-58707-img0002.jpg)
Western Blot: MED10 Antibody [NBP2-58707] - Western blot analysis in control (vector only transfected HEK293T lysate) and MED10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunocytochemistry/Immunofluorescence: MED10 Antibody [NBP2-58707] - Staining of human cell line HeLa shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7263_MED10-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58707-img0001.jpg)
Immunocytochemistry/Immunofluorescence: MED10 Antibody [NBP2-58707] - Staining of human cell line HeLa shows localization to nucleoplasm.