ZNF385B Antibody
| Name | ZNF385B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-58807 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSKHAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKLKASSSSQP |
| Purity/Format | Affinity purified |
| Blocking Peptide | ZNF385B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF385B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF385B Antibody [NBP2-58807] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7489_ZNF385B%2520Antibody-Western%2520Blot-NBP2-58807-img0002.jpg)
Western Blot: ZNF385B Antibody [NBP2-58807] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
![Immunocytochemistry/Immunofluorescence: ZNF385B Antibody [NBP2-58807] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7490_ZNF385B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58807-img0001.jpg)
Immunocytochemistry/Immunofluorescence: ZNF385B Antibody [NBP2-58807] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.