C2orf55 Antibody
| Name | C2orf55 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56290 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LREAAEGLGEDSTGKKKSKFKTFKKFFGKKKRKESPSSTGSSTWKQSQTRNEVIAIESGPVGYDSEDELEESR |
| Purity/Format | Affinity purified |
| Blocking Peptide | C2orf55 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KIAA1211L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C2orf55 Antibody [NBP2-56290] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8167_C2orf55%2520Antibody-Western%2520Blot-NBP2-56290-img0002.jpg)
Western Blot: C2orf55 Antibody [NBP2-56290] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
![Immunocytochemistry/Immunofluorescence: C2orf55 Antibody [NBP2-56290] - Staining of human cell line SiHa shows localization to centrosome, microtubules & cytokinetic bridge.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8168_C2orf55-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56290-img0001.jpg)
Immunocytochemistry/Immunofluorescence: C2orf55 Antibody [NBP2-56290] - Staining of human cell line SiHa shows localization to centrosome, microtubules & cytokinetic bridge.