TBRG4 Antibody
| Name | TBRG4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-58726 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FHQLLCLLNSQIASVWHGTLSKLLGSLYALGIPKASKELQSVEQEVRWRMRKLKYKHLAFLAESCATLSQEQHSQELLAELLTHLERRWTEIEDSHTLVTVMMKVG |
| Purity/Format | Affinity purified |
| Blocking Peptide | TBRG4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TBRG4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: TBRG4 Antibody [NBP2-58726] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8547_TBRG4%2520Antibody-Western%2520Blot-NBP2-58726-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: TBRG4 Antibody [NBP2-58726] - Staining of human cell line A-431 shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8548_TBRG4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58726-img0001.jpg)