DEPDC1B Antibody
| Name | DEPDC1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56444 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IGEVPACRLVHRRQLTEANVEEIWKSMTLSYLQKILGLDSLEEVLDVKLVNSKFIIHNVYSVSKQGVVILDDKSKELPHW |
| Purity/Format | Affinity purified |
| Blocking Peptide | DEPDC1B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DEPDC1B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DEPDC1B Antibody [NBP2-56444] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8576_DEPDC1B%2520Antibody-Western%2520Blot-NBP2-56444-img0002.jpg)
Western Blot: DEPDC1B Antibody [NBP2-56444] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
![Immunocytochemistry/Immunofluorescence: DEPDC1B Antibody [NBP2-56444] - Immunohistochemical staining of human gallbladder shows cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8577_DEPDC1B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56444-img0001.jpg)
Immunocytochemistry/Immunofluorescence: DEPDC1B Antibody [NBP2-56444] - Immunohistochemical staining of human gallbladder shows cytoplasmic positivity in glandular cells.