HADH Antibody
| Name | HADH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-55402 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIV |
| Purity/Format | Affinity purified |
| Blocking Peptide | HADH Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HADHA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HADH Antibody [NBP2-55402] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10466_HADH%2520Antibody-Western%2520Blot-NBP2-55402-img0002.jpg)
Western Blot: HADH Antibody [NBP2-55402] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
![Immunocytochemistry/Immunofluorescence: HADH Antibody [NBP2-55402] - Staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10467_HADH-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55402-img0001.jpg)
Immunocytochemistry/Immunofluorescence: HADH Antibody [NBP2-55402] - Staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.