DNLZ Antibody

Name DNLZ Antibody
Supplier Novus Biologicals
Catalog NBP2-57694
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGE
Purity/Format Affinity purified
Blocking Peptide DNLZ Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene DNLZ
Conjugate Unconjugated
Supplier Page Shop

Product images