NT2NL Antibody
| Name | NT2NL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-59753 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NT2NL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NOTCH2NL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: NT2NL Antibody [NBP2-59753] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line U-87 MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11406_NT2NL-Antibody-Western-Blot-NBP2-59753-img0002.jpg)
![Immunohistochemistry-Paraffin: NT2NL Antibody [NBP2-59753] - Staining of human rectum shows strong cytoplasmic positivity in subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11407_NT2NL-Antibody-Immunohistochemistry-Paraffin-NBP2-59753-img0001.jpg)