FOXL2NB Antibody

Name FOXL2NB Antibody
Supplier Novus Biologicals
Catalog NBP2-57587
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PALVKKRMPDACTLGRAGIGLPKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEA
Purity/Format Affinity purified
Blocking Peptide FOXL2NB Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene FOXL2NB
Conjugate Unconjugated
Supplier Page Shop

Product images