SH2D3A Antibody
| Name | SH2D3A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-57054 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPN |
| Purity/Format | Affinity purified |
| Blocking Peptide | SH2D3A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SH2D3A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SH2D3A Antibody [NBP2-57054] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11495_SH2D3A%2520Antibody-Western%2520Blot-NBP2-57054-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: SH2D3A Antibody [NBP2-57054] - Staining of human cell line A-431 shows localization to nucleoplasm & microtubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11496_SH2D3A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57054-img0001.jpg)