SEC23IP Antibody
| Name | SEC23IP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-58361 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENEEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEM |
| Purity/Format | Affinity purified |
| Blocking Peptide | SEC23IP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SEC23IP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SEC23IP Antibody [NBP2-58361] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11546_SEC23IP%2520Antibody-Western%2520Blot-NBP2-58361-img0002.jpg)
Western Blot: SEC23IP Antibody [NBP2-58361] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
![Immunocytochemistry/Immunofluorescence: SEC23IP Antibody [NBP2-58361] - Staining of human cell line U-2 OS shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11547_SEC23IP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58361-img0001.jpg)
Immunocytochemistry/Immunofluorescence: SEC23IP Antibody [NBP2-58361] - Staining of human cell line U-2 OS shows localization to vesicles.