FAM72A Antibody
| Name | FAM72A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-59790 |
| Prices | $429.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the amino acid sequence:CVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFT |
| Purity/Format | Protein A purified |
| Blocking Peptide | FAM72A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM72A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FAM72A Antibody [NBP2-59790] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19758_FAM72A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-59790-img0002.jpg)
Immunocytochemistry/Immunofluorescence: FAM72A Antibody [NBP2-59790] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles. Antibody staining is shown in green.
![Immunohistochemistry: FAM72A Antibody [NBP2-59790] - Immunohistochemical staining of human soft tissue shows moderate cytoplasmic positivity in peripheral nerve.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19759_FAM72A-Antibody-Immunohistochemistry-NBP2-59790-img0001.jpg)
Immunohistochemistry: FAM72A Antibody [NBP2-59790] - Immunohistochemical staining of human soft tissue shows moderate cytoplasmic positivity in peripheral nerve.