EMID2 Antibody
| Name | EMID2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-59788 |
| Prices | $429.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the amino acid sequence:ANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVP |
| Purity/Format | Protein A purified |
| Blocking Peptide | EMID2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | COL26A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: EMID2 Antibody [NBP2-59788] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19760_EMID2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-59788-img0001.jpg)
Immunocytochemistry/Immunofluorescence: EMID2 Antibody [NBP2-59788] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
![Immunohistochemistry: EMID2 Antibody [NBP2-59788] - Immunohistochemical staining of human vagina shows distinct positivity in extracellular matrix.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19761_EMID2-Antibody-Immunohistochemistry-NBP2-59788-img0002.jpg)
Immunohistochemistry: EMID2 Antibody [NBP2-59788] - Immunohistochemical staining of human vagina shows distinct positivity in extracellular matrix.