NAP1L5 Antibody
| Name | NAP1L5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-55379 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCR |
| Purity/Format | Affinity purified |
| Blocking Peptide | NAP1L5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NAP1L5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: NAP1L5 Antibody [NBP2-55379] - Staining of human cell line BJ shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20054_NAP1L5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55379-img0001.jpg)
Immunocytochemistry/Immunofluorescence: NAP1L5 Antibody [NBP2-55379] - Staining of human cell line BJ shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: NAP1L5 Antibody [NBP2-55379] - Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in a subset of neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20055_NAP1L5%2520Antibody-Immunohistochemistry-Paraffin-NBP2-55379-img0002.jpg)
Immunohistochemistry-Paraffin: NAP1L5 Antibody [NBP2-55379] - Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in a subset of neuronal cells.