NAD Synthetase Antibody

Name NAD Synthetase Antibody
Supplier Novus Biologicals
Catalog NBP2-58373
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ANEGNYRELRWFTPWSRSRHTEEYFLPRMIQDLTKQETVPFGDAVLVTWDTCIGSEICEELWTPHSPHIDMGLDGVEIITNASGSHHVLRKANTRVDLVTMVTSKNGGIY
Purity/Format Affinity purified
Blocking Peptide NAD Synthetase Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene NADSYN1
Conjugate Unconjugated
Supplier Page Shop

Product images