SPG20 Antibody
| Name | SPG20 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-54942 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | SPG20 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SPG20 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SPG20 Antibody [NBP2-54942] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20323_SPG20-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-54942-img0001.jpg)
Immunocytochemistry/Immunofluorescence: SPG20 Antibody [NBP2-54942] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: SPG20 Antibody [NBP2-54942] - Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20324_SPG20%2520Antibody-Immunohistochemistry-Paraffin-NBP2-54942-img0002.jpg)
Immunohistochemistry-Paraffin: SPG20 Antibody [NBP2-54942] - Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.