SLC25A46 Antibody
| Name | SLC25A46 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-57347 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPI |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC25A46 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC25A46 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SLC25A46 Antibody [NBP2-57347] - Western blot analysis in human cell line RT-4.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20427_SLC25A46%2520Antibody-Western%2520Blot-NBP2-57347-img0002.jpg)
![Immunohistochemistry-Paraffin: SLC25A46 Antibody [NBP2-57347] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20428_SLC25A46-Antibody-Immunohistochemistry-Paraffin-NBP2-57347-img0001.jpg)