GPR50 Antibody
| Name | GPR50 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56258 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PTKPAASQLESDTIADLPDPTVVTTSTNDYHDVVVIDVEDDPDEMAV |
| Purity/Format | Affinity purified |
| Blocking Peptide | GPR50 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GPR50 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: GPR50 Antibody [NBP2-56258] - Staining of human cell line HEK 293 shows localization to plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20529_GPR50-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56258-img0001.jpg)
Immunocytochemistry/Immunofluorescence: GPR50 Antibody [NBP2-56258] - Staining of human cell line HEK 293 shows localization to plasma membrane.
![Immunocytochemistry/Immunofluorescence: GPR50 Antibody [NBP2-56258] - Immunohistochemical staining of human placenta shows moderate positivity in a subset of trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20530_GPR50%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56258-img0002.jpg)
Immunocytochemistry/Immunofluorescence: GPR50 Antibody [NBP2-56258] - Immunohistochemical staining of human placenta shows moderate positivity in a subset of trophoblastic cells.