CHST14 Antibody
| Name | CHST14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-57389 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPV |
| Purity/Format | Affinity purified |
| Blocking Peptide | CHST14 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CHST14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: CHST14 Antibody [NBP2-57389] - Western blot analysis in human cell line RT-4.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20590_CHST14%2520Antibody-Western%2520Blot-NBP2-57389-img0002.jpg)
![Immunohistochemistry-Paraffin: CHST14 Antibody [NBP2-57389] - Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20591_CHST14-Antibody-Immunohistochemistry-Paraffin-NBP2-57389-img0001.jpg)