PPAPDC3 Antibody
| Name | PPAPDC3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56028 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPAPDC3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PPAPDC3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PPAPDC3 Antibody [NBP2-56028] - Staining of human cell line U-2 OS shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20642_PPAPDC3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56028-img0001.jpg)
Immunocytochemistry/Immunofluorescence: PPAPDC3 Antibody [NBP2-56028] - Staining of human cell line U-2 OS shows localization to vesicles.
![Immunohistochemistry-Paraffin: PPAPDC3 Antibody [NBP2-56028] - Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20643_PPAPDC3%2520Antibody-Immunohistochemistry-Paraffin-NBP2-56028-img0002.jpg)
Immunohistochemistry-Paraffin: PPAPDC3 Antibody [NBP2-56028] - Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.