KRT85 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-59670
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Rat, Bovine, Cat, Horse, Rabbit, Sheep
• Antigen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT85. 507 amino acids: DVASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLT
• Purity/Format: Affinity purified
• Description: Rabbit Polyclonal
• Gene: KRT85
• Conjugate: Unconjugated