Cyclin J Antibody

Name Cyclin J Antibody
Supplier Novus Biologicals
Catalog NBP2-58810
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHYPCITP
Purity/Format Affinity purified
Blocking Peptide Cyclin J Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CCNJ
Conjugate Unconjugated
Supplier Page Shop

Product images