ATXN7L3B Antibody
| Name | ATXN7L3B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56815 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKCGYFYLEFAETGSVKDFGIQPVEDKGACRLPLCSLPGEPGNGPDQQLQRSPPEFQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | ATXN7L3B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ATXN7L3B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ATXN7L3B Antibody [NBP2-56815] - Staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1651_ATXN7L3B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56815-img0001.jpg)
Immunocytochemistry/Immunofluorescence: ATXN7L3B Antibody [NBP2-56815] - Staining of human cell line U-2 OS shows localization to nucleoplasm.