Adenylate Cyclase 5 Antibody
| Name | Adenylate Cyclase 5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-57976 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF',) |
| Purity/Format | Affinity purified |
| Blocking Peptide | Adenylate Cyclase 5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ADCY5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Adenylate Cyclase 5 Antibody [NBP2-57976] - Staining of human cell line MCF7 shows localization to intermediate filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1834_Adenylate%2520Cyclase%25205%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57976-img0001.jpg)
Immunocytochemistry/Immunofluorescence: Adenylate Cyclase 5 Antibody [NBP2-57976] - Staining of human cell line MCF7 shows localization to intermediate filaments.