PKNOX2 Antibody

Name PKNOX2 Antibody
Supplier Novus Biologicals
Catalog NBP2-57402
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MMQHASPAPALTMMATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQAQLEADKRAVYR
Purity/Format Affinity purified
Blocking Peptide PKNOX2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene PKNOX2
Conjugate Unconjugated
Supplier Page Shop

Product images