HOXA11 Antibody

Name HOXA11 Antibody
Supplier Novus Biologicals
Catalog NBP2-58894
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQF
Purity/Format Affinity purified
Blocking Peptide HOXA11 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene HOXA11
Conjugate Unconjugated
Supplier Page Shop

Product images