CSRP2BP Antibody
| Name | CSRP2BP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-57876 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IYGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQIRSHLH |
| Purity/Format | Affinity purified |
| Blocking Peptide | CSRP2BP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PET117 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CSRP2BP Antibody [NBP2-57876] - Staining of human cell line Hep G2 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3129_CSRP2BP%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57876-img0001.jpg)
Immunocytochemistry/Immunofluorescence: CSRP2BP Antibody [NBP2-57876] - Staining of human cell line Hep G2 shows localization to vesicles.