SLC17A1/NPT Antibody
| Name | SLC17A1/NPT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-55004 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC17A1/NPT Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC17A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC17A1/NPT Antibody [NBP2-55004] - Staining of human cell line A549 shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3153_SLC17A1-NPT%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55004-img0001.jpg)
Immunocytochemistry/Immunofluorescence: SLC17A1/NPT Antibody [NBP2-55004] - Staining of human cell line A549 shows localization to the Golgi apparatus.