KMT2A/MLL Antibody
| Name | KMT2A/MLL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-55237 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKED |
| Purity/Format | Affinity purified |
| Blocking Peptide | KMT2A/MLL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KMT2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: KMT2A/MLL Antibody [NBP2-55237] - Staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3542_KMT2A-MLL%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55237-img0001.jpg)
Immunocytochemistry/Immunofluorescence: KMT2A/MLL Antibody [NBP2-55237] - Staining of human cell line A-431 shows localization to nucleoplasm.