P2Y10/P2RY10 Antibody
| Name | P2Y10/P2RY10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56283 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG |
| Purity/Format | Affinity purified |
| Blocking Peptide | P2Y10/P2RY10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | P2RY10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: P2Y10/P2RY10 Antibody [NBP2-56283] - Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3836_P2Y10-P2RY10%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56283-img0001.jpg)
Immunocytochemistry/Immunofluorescence: P2Y10/P2RY10 Antibody [NBP2-56283] - Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.