BLAME/SLAMF8 Antibody
| Name | BLAME/SLAMF8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56595 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKD |
| Purity/Format | Affinity purified |
| Blocking Peptide | BLAME/SLAMF8 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLAMF8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: BLAME/SLAMF8 Antibody [NBP2-56595] - Immunohistochemical staining of human lymph node shows strong cytoplasmic and nuclear positivity in a small subset of non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4007_BLAME-SLAMF8%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56595-img0001.jpg)
Immunocytochemistry/Immunofluorescence: BLAME/SLAMF8 Antibody [NBP2-56595] - Immunohistochemical staining of human lymph node shows strong cytoplasmic and nuclear positivity in a small subset of non-germinal center cells.