ARMC8 Antibody

Name ARMC8 Antibody
Supplier Novus Biologicals
Catalog NBP2-55188
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDILQKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQERQDKLRDMGIVDILHKLSQSPDSNL
Purity/Format Affinity purified
Blocking Peptide ARMC8 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene ARMC8
Conjugate Unconjugated
Supplier Page Shop

Product images