Parvin gamma Antibody
| Name | Parvin gamma Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-58033 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVN |
| Purity/Format | Affinity purified |
| Blocking Peptide | Parvin gamma Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PARVG |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Parvin gamma Antibody [NBP2-58033] - Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12871_Parvin%2520gamma%2520Antibody-Immunohistochemistry-Paraffin-NBP2-58033-img0001.jpg)
Immunohistochemistry-Paraffin: Parvin gamma Antibody [NBP2-58033] - Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and membranous positivity in glandular cells.