KRT84 Antibody
| Name | KRT84 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-58176 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CGVRFGAGCGMGFGDGRGVGLGPRADSCVGLGFGAGSGIGYGFGGPGFGYRVGGVGVPAAPSITAV |
| Purity/Format | Affinity purified |
| Blocking Peptide | KRT84 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KRT84 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: KRT84 Antibody [NBP2-58176] - Immunohistochemical staining of human endometrium shows cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12877_KRT84%2520Antibody-Immunohistochemistry-Paraffin-NBP2-58176-img0001.jpg)
Immunohistochemistry-Paraffin: KRT84 Antibody [NBP2-58176] - Immunohistochemical staining of human endometrium shows cytoplasmic and membranous positivity in glandular cells.