PABPC1L2A Antibody
| Name | PABPC1L2A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-54693 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a Recombinant Protein corresponding to amino acids:KSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PABPC1L2A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PABPC1L2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PABPC1L2A Antibody [NBP2-54693] - Staining of human hypothalamus shows strong positivity in processes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12945_PABPC1L2A%2520Antibody-Immunohistochemistry-Paraffin-NBP2-54693-img0002.jpg)
Immunohistochemistry-Paraffin: PABPC1L2A Antibody [NBP2-54693] - Staining of human hypothalamus shows strong positivity in processes.