SCP3/SYCP3 Antibody
| Name | SCP3/SYCP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-54713 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a Recombinant Protein corresponding to amino acids:KYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SCP3/SYCP3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SYCP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: SCP3/SYCP3 Antibody [NBP2-54713] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12965_SCP3-SYCP3-Antibody-Immunohistochemistry-Paraffin-NBP2-54713-img0001.jpg)
Immunohistochemistry-Paraffin: SCP3/SYCP3 Antibody [NBP2-54713] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.