PPP2R2A Antibody
| Name | PPP2R2A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56935 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEGAGGGNDIQWCFSQVKGAVDDDVAEADI |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPP2R2A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PPP2R2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PPP2R2A Antibody [NBP2-56935] - Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/13004_PPP2R2A%2520Antibody-Immunohistochemistry-Paraffin-NBP2-56935-img0001.jpg)
Immunohistochemistry-Paraffin: PPP2R2A Antibody [NBP2-56935] - Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.