TSPY4 Antibody

Name TSPY4 Antibody
Supplier Novus Biologicals
Catalog NBP2-59797
Prices $429.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to the amino acid sequence:EEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAF
Purity/Format Protein A purified
Blocking Peptide TSPY4 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene TSPY4
Conjugate Unconjugated
Supplier Page Shop