Name | Anti-NGLY1 polyclonal antibody |
---|---|
Supplier | Creative Diagnostics |
Catalog | CABT-B8983 |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | The immunogen is a synthetic peptide directed towards the middle region of Human NGLY1. Synthetic peptide located within the following region: DRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGRCG |
Description | Rabbit Polyclonal |
Gene | NGLY1 |
Conjugate | Unconjugated |
Supplier Page | Shop |