Anti-NGLY1 polyclonal antibody

Name Anti-NGLY1 polyclonal antibody
Supplier Creative Diagnostics
Catalog CABT-B8983
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen is a synthetic peptide directed towards the middle region of Human NGLY1. Synthetic peptide located within the following region: DRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGRCG
Description Rabbit Polyclonal
Gene NGLY1
Conjugate Unconjugated
Supplier Page Shop