| Name | SLFNL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-58744 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRNMEFKRGSGEYLSLAFKHHVRRYVCAFLNSEGGSLLVGVEDSGLVQGIRCSHRDEDRARLLVDSILQGFKPQIFPDAYTLTFIPVISTSETS |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLFNL1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLFNL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |