VDP p115 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-55590
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DNSLESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEE
• Purity/Format: Affinity purified
• Blocking Peptide: VDP p115 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: USO1
• Conjugate: Unconjugated