| Name | FAM81A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56437 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLDRDQLQKQIQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM81A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM81A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |