| Name | SLC39A10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-57813 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ERYGENGRLSFFGLEKLLTNLGLGERKVVEINHEDLGHDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQTVTSVSTK |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC39A10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC39A10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |